PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_17238A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB_related
Protein Properties Length: 293aa    MW: 32432.3 Da    PI: 6.5164
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_17238AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding271e-081521881147
                                HHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
            Myb_DNA-binding  11 llvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                l++++   +G g+Wk I+r++ k++t+ q+ s+ qky
  Oropetium_20150105_17238A 152 LFLQGLDVYGRGNWKNISRHFVKTKTPVQVSSHAQKY 188
                                7999********************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.956138193IPR017930Myb domain
CDDcd001671.31E-5151189No hitNo description
TIGRFAMsTIGR015571.2E-9151191IPR006447Myb domain, plants
SuperFamilySSF466891.06E-10151194IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.9E-5152192IPR009057Homeodomain-like
PfamPF002492.0E-5152188IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MAAPAHIGPM FNKEWSPSDI AQVKSLIVMY NDNNKSASCN GDNNKMNNNK HKSIVDLLHA  60
QFPWKDRHQV SDLYVEIVLD MIECERKKMD KQSGPTTMAA AGIDLVNDNF GIPVVVEDPA  120
KKKNMEVLLG PQNMLADTKS RKTVEKHASA RLFLQGLDVY GRGNWKNISR HFVKTKTPVQ  180
VSSHAQKYFR RKESTATKKR YSINDVGLYD AEPWEAPDSS GWEALPFAAS GSYDFNDSAL  240
DLDGQGSTTH SQVWSPLLYD IGETSTNQAN PEVVGIENFA PGNQQGAFAP QD*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004963442.12e-63PREDICTED: uncharacterized protein LOC101780786
TrEMBLK3ZF272e-63K3ZF27_SETIT; Uncharacterized protein
STRINGSi025176m7e-63(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP84230133
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08520.13e-17MYB family protein